PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0271s0190.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 499aa    MW: 55763.8 Da    PI: 5.0841
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0271s0190.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM142.72.1e-44441692128
                     NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             ppG+rF+P+d+el+ +yL +k+++++l+  + i+ev +y+++P++L  +    +ekewyf ++rd+ky++g+r+nra+ +gyWkatg
  SapurV1A.0271s0190.1.p  44 PPGYRFKPKDQELILYYLLNKIKNRPLPS-NGIHEVTLYRYNPETLTgNYEPYGEKEWYFLTPRDRKYPKGDRPNRAAGDGYWKATG 129
                             9***************************9.77**************9444445899******************************* PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              dk+v+   ++++g kktLvfy+g++p g+kt+W+m eyr+
  SapurV1A.0271s0190.1.p 130 ADKDVIY-ARQVIGSKKTLVFYRGKSPGGVKTNWIMREYRA 169
                             *******.8999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-5441196IPR003441NAC domain
PROSITE profilePS5100551.68143196IPR003441NAC domain
PfamPF023651.7E-2344168IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MEDQRRGAGL TNPVNNSSTT CPSQAQPAVN PGQFAERGQE DKYPPGYRFK PKDQELILYY  60
LLNKIKNRPL PSNGIHEVTL YRYNPETLTG NYEPYGEKEW YFLTPRDRKY PKGDRPNRAA  120
GDGYWKATGA DKDVIYARQV IGSKKTLVFY RGKSPGGVKT NWIMREYRAS NSDGAPQRAN  180
NTMRLDDWVL CRIHNKKDSF PRSRMNGLLD DENEDQPLEN NGNLAPHQVV VPDISGNHNP  240
GDSANHQNSQ NGLVAGVSNV LAVADNTPYA NYAYAYPQNS QDGLVARVSQ YHEVTSVPTM  300
AGNYNIESQM GYLGRYGNFS SVYPQNSQNE LVGGVSQYHE VTGVSTVTRD YNIESQMGYL  360
GRYGNFSSVY PQNSQNELVG GVSQYHEVTG VSTVTRDYNL ESQMGYLGRY GDSASAYPQN  420
YQNRMTGVSQ YNAFPGIPQT TDLQPEQTSN YVQKTLLDHE LSSSQMDGED SYDFGENDDY  480
LFGLDSDVTF STSSDDHH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B8e-514419918168NAC domain-containing protein 19
4dul_A8e-514419918168NAC domain-containing protein 19
1ut7_B8e-514419918168NO APICAL MERISTEM PROTEIN
1ut7_A8e-514419918168NO APICAL MERISTEM PROTEIN
1ut4_B8e-514419918168NO APICAL MERISTEM PROTEIN
1ut4_A8e-514419918168NO APICAL MERISTEM PROTEIN
3swp_D1e-504419921171NAC domain-containing protein 19
3swp_C1e-504419921171NAC domain-containing protein 19
3swp_B1e-504419921171NAC domain-containing protein 19
3swp_A1e-504419921171NAC domain-containing protein 19
3swm_D1e-504419921171NAC domain-containing protein 19
3swm_C1e-504419921171NAC domain-containing protein 19
3swm_B1e-504419921171NAC domain-containing protein 19
3swm_A1e-504419921171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002325069.10.0hypothetical protein POPTR_0018s10310g
TrEMBLB9IM140.0B9IM14_POPTR; Uncharacterized protein
STRINGPOPTR_0018s10310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2809633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.14e-62NAC domain containing protein 32